Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast OV16 protein

This Yeast OV16 protein spans the amino acid sequence from region 17-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OV16

UniProt

P31729

Expression Region

17-197aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Onchocerca volvulus

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDAEPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQPGSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethyl 2-Phosphonopropionate
TRC-T798110-50G 50 g

Triethyl 2-Phosphonopropionate

Sign In for Pricing
View Details
Coumarin 307
TRC-C755513-100MG 100 mg

Coumarin 307

Sign In for Pricing
View Details
NT5C1A Human Gene Knockout Kit (CRISPR)
KN424617 1 Kit

NT5C1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Casr activation kit by CRISPRa
GA200545 1 Kit

Mouse Casr activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse CD68 Recombinant Rabbit monoclonal Antibody
HA723447 100 µL

Mouse CD68 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Polystyrene PHB (Wang resin)
H12516013.100G 100 g

Polystyrene PHB (Wang resin)

Sign In for Pricing
View Details