Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast rodA protein

This Yeast rodA protein spans the amino acid sequence from region 19-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RodA

UniProt

P41746

Expression Region

19-159aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPQHDVNAAGNGVGNKGNANVRFPVPDDITVKQATEKCGDQAQLSCCNKATYAGDVTDIDEGILAGTLKNLIGGGSGTEGLGLFNQCSKLDLQIPVIGIPIQALVNQKCKQNIACCQNSPSDASGSLIGLGLPCIALGSIL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone
OR1091719-01 250 mg

1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone

Sign In for Pricing
View Details
1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone
OR1091719-02 500 mg

1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone

Sign In for Pricing
View Details
1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone
OR1091719-03 1 g

1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone

Sign In for Pricing
View Details
1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone
OR1091719-04 5 g

1- (4-methyl-5- (methylthio) thiophen-2-yl) ethanone

Sign In for Pricing
View Details
Multiplex Assay Kit for Fibroblast Growth Factor 21 (FGF21), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029624 96 Tests

Multiplex Assay Kit for Fibroblast Growth Factor 21 (FGF21), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Anti-JAK2 Antibody (R2V37)
RHA97304 100 μg

Anti-JAK2 Antibody (R2V37)

Sign In for Pricing
View Details