Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S protein

This Human S protein spans the amino acid sequence from region 15-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S

UniProt

P36334

Expression Region

15-344aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD33 (gp67, My9, Myeloid cell surface antigen CD33, p67, Sialic acid-binding Ig-like lectin 3 (Siglec 3) ) (Biotin)
168690-AF-Biotin 100 µL

CD33 (gp67, My9, Myeloid cell surface antigen CD33, p67, Sialic acid-binding Ig-like lectin 3 (Siglec 3) ) (Biotin)

Sign In for Pricing
View Details
Menin recombinant monoclonal antibody
A5409 100ul X 3

Menin recombinant monoclonal antibody

Sign In for Pricing
View Details
ARPC1B 3'UTR Luciferase Stable Cell Line
TU001174 1.0 mL

ARPC1B 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ADAD2 antibody
70R-4837 100 µL

ADAD2 antibody

Sign In for Pricing
View Details
VEGFB Rabbit monoclonal antibody
BS41147-01 50 µL

VEGFB Rabbit monoclonal antibody

Sign In for Pricing
View Details
VEGFB Rabbit monoclonal antibody
BS41147-02 100 µL

VEGFB Rabbit monoclonal antibody

Sign In for Pricing
View Details