Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human S protein

This Human S protein spans the amino acid sequence from region 15-344aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S

UniProt

P36334

Expression Region

15-344aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human coronavirus OC43 (HCoV-OC43)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VIGDLKCTSDNINDKDTGPPPISTDTVDVTNGLGTYYVLDRVYLNTTLFLNGYYPTSGSTYRNMALKGSVLLSRLWFKPPFLSDFINGIFAKVKNTKVIKDRVMYSEFPAITIGSTFVNTSYSVVVQPRTINSTQDGDNKLQGLLEVSVCQYNMCEYPQTICHPNLGNHRKELWHLDTGVVSCLYKRNFTYDVNADYLYFHFYQEGGTFYAYFTDTGVVTKFLFNVYLGMALSHYYVMPLTCNSKLTLEYWVTPLTSRQYLLAFNQDGIIFNAEDCMSDFMSEIKCKTQSIAPPTGVYELNGYTVQPIADVYRRKPNLPNCNIEAWLNDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MVP Antibody Picoband® (monoclonal, 8B12) (Dylight488 Conjugate)
M00642-1-Dylight488 100 µg

Anti-MVP Antibody Picoband® (monoclonal, 8B12) (Dylight488 Conjugate)

Sign In for Pricing
View Details
Myoglobin (17N17) Rabbit Monoclonal Antibody
AMRe14338-01 50 µL

Myoglobin (17N17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Myoglobin (17N17) Rabbit Monoclonal Antibody
AMRe14338-02 100 µL

Myoglobin (17N17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Myoglobin (17N17) Rabbit Monoclonal Antibody
AMRe14338-03 200 µL

Myoglobin (17N17) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PCNT Antibody
orb2676834-01 50 µL

PCNT Antibody

Sign In for Pricing
View Details
PCNT Antibody
orb2676834-02 100 µL

PCNT Antibody

Sign In for Pricing
View Details