Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast sso7d protein

This Yeast sso7d protein spans the amino acid sequence from region 2-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sso7d

UniProt

P39476

Expression Region

2-64aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vgll3 Mouse Gene Knockout Kit (CRISPR)
KN518886 1 Kit

Vgll3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF647 conjugate, 0.1mg/mL
BNC472617-500 1x 500 µL

Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2617), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)
PKSH031569 50 µg

Recombinant Human Carboxypeptidase A2/CPA2 Protein (His Tag)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Bone
CB501643 1 Block

Frozen Tissue Blocks, Bone

Sign In for Pricing
View Details
Human GC (Glucagon) ELISA Kit
E-EL-H2237-01 24 Tests

Human GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details
Human GC (Glucagon) ELISA Kit
E-EL-H2237-02 48 Tests

Human GC (Glucagon) ELISA Kit

Sign In for Pricing
View Details