Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XCL1 protein

This Human XCL1 protein spans the amino acid sequence from region 22-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XCL1

UniProt

P47992

Expression Region

22-114aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSSK4 polyclonal antibody
BS62495-01 50 µL

TSSK4 polyclonal antibody

Sign In for Pricing
View Details
TSSK4 polyclonal antibody
BS62495-02 100 µL

TSSK4 polyclonal antibody

Sign In for Pricing
View Details
Angiostatin K1-3 BioAssayTM ELISA Kit, Human
143717 96 Tests

Angiostatin K1-3 BioAssayTM ELISA Kit, Human

Sign In for Pricing
View Details
Cytochrome P450 26C1 Peptide
DF4743-BP 1 mg

Cytochrome P450 26C1 Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
MBS2026831-01 0.1 mL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details
Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)
MBS2026831-02 0.2 mL

Polyclonal Antibody to Microfibrillar Associated Protein 2 (MFAP2)

Sign In for Pricing
View Details