Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human XCL1 protein

This Human XCL1 protein spans the amino acid sequence from region 22-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

XCL1

UniProt

P47992

Expression Region

22-114aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5B Human Pre-designed siRNA Set A
HY-RS13893 1 Set

STAT5B Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Procainamide HCl
S4294-200mg 200 mg

Procainamide HCl

Sign In for Pricing
View Details
15-Hydroxy-5,6-oxido-7,9,11,13-eicosatetraenoic acid
orb3179841-01 10 mg

15-Hydroxy-5,6-oxido-7,9,11,13-eicosatetraenoic acid

Sign In for Pricing
View Details
15-Hydroxy-5,6-oxido-7,9,11,13-eicosatetraenoic acid
orb3179841-02 50 mg

15-Hydroxy-5,6-oxido-7,9,11,13-eicosatetraenoic acid

Sign In for Pricing
View Details
WRN inhibitor 10
HY-163797 1 Each

WRN inhibitor 10

Sign In for Pricing
View Details
Human PRDM1 Knockout A549 cell line
GTR15408090 1 Vial

Human PRDM1 Knockout A549 cell line

Sign In for Pricing
View Details