Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VP1 protein

This Human VP1 protein spans the amino acid sequence from region 571-857aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VP1

UniProt

P23008

Expression Region

571-857aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Human rhinovirus 1A (HRV-1A)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NPVENYIDEVLNEVLVVPNIKESHHTTSNSAPLLDAAETGHTSNVQPEDAIETRYVITSQTRDEMSIESFLGRSGCVHISRIKVDYTDYNGQDINFTKWKITLQEMAQIRRKFELFTYVRFDSEITLVPCIAGRGDDIGHIVMQYMYVPPGAPIPSKRNDFSWQSGTNMSIFWQHGQPFPRFSLPFLSIASAYYMFYDGYDGDNTSSKYGSVVTNDMGTICSRIVTEKQKHSVVITTHIYHKAKHTKAWCPRPPRAVPYTHSHVTNYMPETGDVTTAIVRRNTITTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Umeclidinium (bromide)
HY-12100-01 5 mg

Umeclidinium (bromide)

Sign In for Pricing
View Details
Umeclidinium (bromide)
HY-12100-02 10 mM - 1 mL

Umeclidinium (bromide)

Sign In for Pricing
View Details
Umeclidinium (bromide)
HY-12100-03 10 mg

Umeclidinium (bromide)

Sign In for Pricing
View Details
Umeclidinium (bromide)
HY-12100-04 25 mg

Umeclidinium (bromide)

Sign In for Pricing
View Details
Umeclidinium (bromide)
HY-12100-05 50 mg

Umeclidinium (bromide)

Sign In for Pricing
View Details
F (ab') 2 Sheep IgG (H&L) Antibody Texas Red Conjugated
orb348385 500 μL

F (ab') 2 Sheep IgG (H&L) Antibody Texas Red Conjugated

Sign In for Pricing
View Details