Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast GM2S-1 protein

This Yeast GM2S-1 protein spans the amino acid sequence from region 22-158aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GM2S-1

UniProt

P19594

Expression Region

22-158aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-01 0.1 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details
Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-02 0.2 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details
Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-03 0.5 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details
Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-04 1 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details
Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-05 5 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details
Monoclonal Antibody to Relaxin 3 (RLN3)
MBS2152679-06 5x 5 mL

Monoclonal Antibody to Relaxin 3 (RLN3)

Sign In for Pricing
View Details