Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast IFNT1 protein

This Yeast IFNT1 protein spans the amino acid sequence from region 24-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNT1

UniProt

P15696

Expression Region

24-195aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Bos taurus (Bovine)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM10 Polyclonal Antibody
E-AB-52781-01 20 µL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details
RBM10 Polyclonal Antibody
E-AB-52781-02 60 µL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details
RBM10 Polyclonal Antibody
E-AB-52781-03 120 µL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details
RBM10 Polyclonal Antibody
E-AB-52781-04 200 µL

RBM10 Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF594 conjugate, 0.1mg/mL
BNC942174-100 1x 100 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ranbp2 Mouse Gene Knockout Kit (CRISPR)
KN514457 1 Kit

Ranbp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details