What is the catalog number for Recombinant Rabies virus Matrix protein (M)?

The catalog number for Recombinant Rabies virus Matrix protein (M) is orb246064.

What sizes are available for Recombinant Rabies virus Matrix protein (M)?

Recombinant Rabies virus Matrix protein (M) is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Rabies virus Matrix protein (M) come in?

Recombinant Rabies virus Matrix protein (M) is available in 3 different pack sizes.

Is Recombinant Rabies virus Matrix protein (M) in stock?

Recombinant Rabies virus Matrix protein (M) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Rabies virus Matrix protein (M)

This yeast recombinant rabies virus matrix protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

M; Matrix protein; Phosphoprotein M2

UniProt

P15200

Expression Region

1-202aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rabies virus (strain PM) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE