Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Cxcl16 protein

This Mouse Cxcl16 protein spans the amino acid sequence from region 27-198aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cxcl16, Srpsox

UniProt

Q8BSU2

Expression Region

27-198aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLPQASTQTPEAAEGTPSDTSTPAHSQSTQHSTLPSGALSLNKEHTQPWEMTTLPSGYGLEARPEAEANEKQQDDRQQEAPGAGAST

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C-C motif chemokine 17 protein (CCL17), Active Protein
RPC28840-01 Inquire

Recombinant Human C-C motif chemokine 17 protein (CCL17), Active Protein

Sign In for Pricing
View Details
Recombinant Human C-C motif chemokine 17 protein (CCL17), Active Protein
RPC28840-02 100 µg

Recombinant Human C-C motif chemokine 17 protein (CCL17), Active Protein

Sign In for Pricing
View Details
Mouse Monoclonal E-Cadherin Antibody (CDH1/1525) - Azide and BSA Free
NBP2-54551-100ug 100 µg

Mouse Monoclonal E-Cadherin Antibody (CDH1/1525) - Azide and BSA Free

Sign In for Pricing
View Details
Rabbit Monoclonal IFN-alpha G/IFNA5 Antibody (102) [PerCP]
NBP2-89436PCP 0.1 mL

Rabbit Monoclonal IFN-alpha G/IFNA5 Antibody (102) [PerCP]

Sign In for Pricing
View Details
TBS,20x
T1080 500 mL

TBS,20x

Sign In for Pricing
View Details
ATG10 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-61475R-PE-Cy5.5 100 µL

ATG10 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details