Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CXCL14 protein

This Mouse CXCL14 protein spans the amino acid sequence from region 23-99aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 14 protein, Chaemokine, CXC motif, ligand 14 protein, Chemokine (C-X-C motif) ligand 14 protein, Chemokine BRAK protein, CXC chemokine in breast and kidney protein, CXCL 14 protein, CXCL-14 protein, CXCL14 protein, CXL14_HUMAN protein, JSC protein, Kec protein, Kidney-expressed chemokine CXC protein, KS1 protein, MGC10687 protein, MGC124510 protein, MGC90667 protein, 1110031L23Rik protein, 1200006I23Rik protein, AI414372 protein, BMAC protein, bolekine protein, MIP 2 gamma protein, MIP-2G protein, MIP2G protein, MIP2gamma protein, NJAC protein, PRO273 protein, PSEC0212 protein, Scyb14 protein, Small Inducible Cytokine B14 protein, Small inducible cytokine subfamily B (Cys-X-Cys) member 14 (BRAK) protein, Small Inducible Cytokine subfamily B, member 14 protein, Small-inducible cytokine B14 protein, UNQ240 protein, CXC-X3 protein, BRAKKEC protein, member 14 (BRAK) protein, MIP-2 gamma protein, NJACKec protein, SCYB14MGC10687 protein

UniProt

Q9WUQ5

Expression Region

23-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMC3 (Cancer/testis antigen 81) Polyclonal Antibody
MBS9238385-01 0.1 mL

ARMC3 (Cancer/testis antigen 81) Polyclonal Antibody

Sign In for Pricing
View Details
ARMC3 (Cancer/testis antigen 81) Polyclonal Antibody
MBS9238385-02 5x 0.1 mL

ARMC3 (Cancer/testis antigen 81) Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Kcna5 shRNA (UAS) - Lentiviral mouse Kcna5 shRNA (UAS) (25)
GTR15272417 1 Vial

Lentiviral mouse Kcna5 shRNA (UAS) - Lentiviral mouse Kcna5 shRNA (UAS) (25)

Sign In for Pricing
View Details
G-Melanocyte Stimulating Hormone (Melanocyte Stimulating Hormone gamma, Gamma-MSH, Melanotropin gamma)
M2868-74W 400 µg

G-Melanocyte Stimulating Hormone (Melanocyte Stimulating Hormone gamma, Gamma-MSH, Melanotropin gamma)

Sign In for Pricing
View Details
Propionyl-CoA carboxylase beta chain, mitochondrial
orb1638777-01 50 µg

Propionyl-CoA carboxylase beta chain, mitochondrial

Sign In for Pricing
View Details
Propionyl-CoA carboxylase beta chain, mitochondrial
orb1638777-02 100 µg

Propionyl-CoA carboxylase beta chain, mitochondrial

Sign In for Pricing
View Details