Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pla2g2a protein

This Rat Pla2g2a protein spans the amino acid sequence from region 22-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g2a

UniProt

P14423

Expression Region

22-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Interleukin 27 (IL27) ELISA Kit
MBS456882-01 48 Tests

Mouse Interleukin 27 (IL27) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 27 (IL27) ELISA Kit
MBS456882-02 96 Tests

Mouse Interleukin 27 (IL27) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 27 (IL27) ELISA Kit
MBS456882-03 5x 96 Tests

Mouse Interleukin 27 (IL27) ELISA Kit

Sign In for Pricing
View Details
Mouse Interleukin 27 (IL27) ELISA Kit
MBS456882-04 10x 96 Tests

Mouse Interleukin 27 (IL27) ELISA Kit

Sign In for Pricing
View Details
Pax-3 Double Nickase Plasmid (h2)
sc-401657-NIC-2 20 µg

Pax-3 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Lentiviral human OPN1SW sgRNA gene knockout kit - Lentiviral human OPN1SW sgRNA gene knockout kit (plasmid)
GTR15392675 1 Vial

Lentiviral human OPN1SW sgRNA gene knockout kit - Lentiviral human OPN1SW sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details