Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Pla2g2a protein

This Rat Pla2g2a protein spans the amino acid sequence from region 22-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pla2g2a

UniProt

P14423

Expression Region

22-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SLLEFGQMILFKTGKRADVSYGFYGCHCGVGGRGSPKDATDWCCVTHDCCYNRLEKRGCGTKFLTYKFSYRGGQISCSTNQDSCRKQLCQCDKAAAECFARNKKSYSLKYQFYPNKFCKGKTPSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA2026 CRISPR Knock Out 293T Cell Line (Human)
25652141 1x 10^6 Cells / 1.0 mL

KIAA2026 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
ST3GAL2 Antibody, HRP conjugated
A54864-100UG 100 µg

ST3GAL2 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human STAG3OS Protein - (Dry Ice)
H00352954-P01-10ug 10 µg

Recombinant Human STAG3OS Protein - (Dry Ice)

Sign In for Pricing
View Details
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2)
orb2902680-01 20 µg

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2)

Sign In for Pricing
View Details
Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2)
orb2902680-02 100 µg

Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2)

Sign In for Pricing
View Details
PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (FITC)
MBS6124435-01 0.1 mL

PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (FITC)

Sign In for Pricing
View Details