Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Scyb11 protein

This Mouse Scyb11 protein spans the amino acid sequence from region 22-98aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Scyb11

UniProt

Q9JHH5

Expression Region

22-98aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homeo box C10 Rabbit Polyclonal Antibody (PE)
orb492949 100 µL

Homeo box C10 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
SP2 transcription factor Rabbit pAb, PE-Cy5 conjugated
orb2851349 100 µL

SP2 transcription factor Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
VASH2, CT (VASH2, VASHL, Vasohibin-2, Vasohibin-like protein) (MaxLight 490) discontinued
043718-ML490 100 µL

VASH2, CT (VASH2, VASHL, Vasohibin-2, Vasohibin-like protein) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)
MBS2104535-01 5x 96 Tests

Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)
MBS2104535-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)
MBS2104535-03 10x 96 Tests

Human Cytochrome P450 3A7 (CYP3A7) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details