Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mup2 protein

This Mouse Mup2 protein spans the amino acid sequence from region 19-180aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mup2

UniProt

P11589

Expression Region

19-180aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human PTCH1 Nanobody (SAA1006)
HC307023-01 50 µg

Anti-Human PTCH1 Nanobody (SAA1006)

Sign In for Pricing
View Details
Anti-Human PTCH1 Nanobody (SAA1006)
HC307023-02 100 µg

Anti-Human PTCH1 Nanobody (SAA1006)

Sign In for Pricing
View Details
Anti-Human PTCH1 Nanobody (SAA1006)
HC307023-03 1 mg

Anti-Human PTCH1 Nanobody (SAA1006)

Sign In for Pricing
View Details
Human Helicobacter Pylori Antibody ELISA Kit
MBS3802210-01 48 Well

Human Helicobacter Pylori Antibody ELISA Kit

Sign In for Pricing
View Details
Human Helicobacter Pylori Antibody ELISA Kit
MBS3802210-02 96 Well

Human Helicobacter Pylori Antibody ELISA Kit

Sign In for Pricing
View Details
Human Helicobacter Pylori Antibody ELISA Kit
MBS3802210-03 5x 96 Well

Human Helicobacter Pylori Antibody ELISA Kit

Sign In for Pricing
View Details