Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast Con-ikot-ikot protein

This Yeast Con-ikot-ikot protein spans the amino acid sequence from region 38-123aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Con-ikot-ikot

UniProt

P0CB20

Expression Region

38-123aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Conus striatus (Striated cone)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPADCCRMKECCTDRVNECLQRYSGREDKFVSFCYQEATVTCGSFNEIVGCCYGYQMCMIRVVKPNSLSGAHEACKTVSCGNPCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbfox1 Rabbit Polyclonal Antibody
TA363212 100 µL

Rbfox1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MyD88 Recombinant Rabbit monoclonal Antibody
HA751021 100 µL

MyD88 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Corrosion-Preventive Properties Tester BPTL-223
BPTL-223 1 Unit

Corrosion-Preventive Properties Tester BPTL-223

Sign In for Pricing
View Details
CHGA Polyclonal Antibody
AN005870L-01 25 µL

CHGA Polyclonal Antibody

Sign In for Pricing
View Details
CHGA Polyclonal Antibody
AN005870L-02 100 µL

CHGA Polyclonal Antibody

Sign In for Pricing
View Details
Human APPD (PLEKHF1) activation kit by CRISPRa
GA112391 1 Kit

Human APPD (PLEKHF1) activation kit by CRISPRa

Sign In for Pricing
View Details