Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast degP protein

This Yeast degP protein spans the amino acid sequence from region 27-474aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DegP

UniProt

P0C0V0

Expression Region

27-474aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Debaryomyces hansenii Glucose N-acetyltransferase 1 (GNT1)
MBS7087101 Inquire

Recombinant Debaryomyces hansenii Glucose N-acetyltransferase 1 (GNT1)

Sign In for Pricing
View Details
Anti-Purple sea urchin Integrin B1A Antibody, APC Conjugate
DZ41543-APC 200 µL/Vial

Anti-Purple sea urchin Integrin B1A Antibody, APC Conjugate

Sign In for Pricing
View Details
mmu-miR-5113 miRNA Antagomir
MNM02231 2x 5.0 nmol

mmu-miR-5113 miRNA Antagomir

Sign In for Pricing
View Details
PERK, Phosphorylated (T981) (EIF2AK3, Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, PRKR-like Endoplasmic Reticulum Kinase, Pancreatic EIF2-alpha Kinase, Pek, Perk, WRS) (MaxLight 405)
MBS6448334-01 0.1 mL

PERK, Phosphorylated (T981) (EIF2AK3, Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, PRKR-like Endoplasmic Reticulum Kinase, Pancreatic EIF2-alpha Kinase, Pek, Perk, WRS) (MaxLight 405)

Sign In for Pricing
View Details
PERK, Phosphorylated (T981) (EIF2AK3, Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, PRKR-like Endoplasmic Reticulum Kinase, Pancreatic EIF2-alpha Kinase, Pek, Perk, WRS) (MaxLight 405)
MBS6448334-02 5x 0.1 mL

PERK, Phosphorylated (T981) (EIF2AK3, Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, PRKR-like Endoplasmic Reticulum Kinase, Pancreatic EIF2-alpha Kinase, Pek, Perk, WRS) (MaxLight 405)

Sign In for Pricing
View Details
Hamster Neonatal Thyroxine ELISA Kit
MBS046194-01 48 Well

Hamster Neonatal Thyroxine ELISA Kit

Sign In for Pricing
View Details