Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast degP protein

This Yeast degP protein spans the amino acid sequence from region 27-474aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DegP

UniProt

P0C0V0

Expression Region

27-474aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5HT1A Receptor/HTR1A Rabbit Polyclonal Antibody (Biotin)
orb2577818 100 µg

5HT1A Receptor/HTR1A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Phospho-STAT5A (Ser780) Antibody
E18-3303-2 100 µg -100 µL

Phospho-STAT5A (Ser780) Antibody

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2120919-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2120919-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2120919-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)
MBS2120919-04 1 mL

Cy3-Linked Monoclonal Antibody to Superoxide Dismutase 3, Extracellular (SOD3)

Sign In for Pricing
View Details