Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TUBB2A protein

This Human TUBB2A protein spans the amino acid sequence from region 1-445aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TUBB2A

UniProt

Q13885

Expression Region

1-445aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPBC115.02c Antibody
orb856449 2 mg

SPBC115.02c Antibody

Sign In for Pricing
View Details
Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated
MBS1497454-01 0.05 mg

Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated
MBS1497454-02 0.1 mg

Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated
MBS1497454-03 5x 0.1 mg

Rabbit anti-human Keratin, type II cytoskeletal 6A polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
ZFP64 (Zinc Finger Protein 64 Homolog, isoforms 1 and 2, Zfp-64, Zinc Finger Protein 338, ZFP64, ZNF338) (PE) discontinued
302859-PE 100 µL

ZFP64 (Zinc Finger Protein 64 Homolog, isoforms 1 and 2, Zfp-64, Zinc Finger Protein 338, ZFP64, ZNF338) (PE) discontinued

Sign In for Pricing
View Details
PCDH8 (Protocadherin-8, Arcadlin) (MaxLight 405)
MBS6191659-01 0.1 mL

PCDH8 (Protocadherin-8, Arcadlin) (MaxLight 405)

Sign In for Pricing
View Details