Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSPAN7 protein

This Human TSPAN7 protein spans the amino acid sequence from region 113-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TSPAN7

UniProt

P41732

Expression Region

113-223aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD19 Protein, C-Fc
orb3153087-01 50 µg

Recombinant Human CD19 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD19 Protein, C-Fc
orb3153087-02 100 µg

Recombinant Human CD19 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human CD19 Protein, C-Fc
orb3153087-03 1 mg

Recombinant Human CD19 Protein, C-Fc

Sign In for Pricing
View Details
RAPGEFL1 Rabbit Polyclonal Antibody
orb587733 100 µL

RAPGEFL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sephin1 (Icerguastat) 100mg
A12791-100 100 mg

Sephin1 (Icerguastat) 100mg

Sign In for Pricing
View Details
Human NUP98 shRNA Plasmid
abx953278-01 150 µg

Human NUP98 shRNA Plasmid

Sign In for Pricing
View Details