Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSPAN7 protein

This Human TSPAN7 protein spans the amino acid sequence from region 113-223aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TSPAN7

UniProt

P41732

Expression Region

113-223aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADH4 (NM_000670) Human Tagged ORF Clone
RC204750 10 µg

ADH4 (NM_000670) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat F-box only protein 38 (FBXO38) ELISA Kit
MBS7208826-01 48 Well

Rat F-box only protein 38 (FBXO38) ELISA Kit

Sign In for Pricing
View Details
Rat F-box only protein 38 (FBXO38) ELISA Kit
MBS7208826-02 96 Well

Rat F-box only protein 38 (FBXO38) ELISA Kit

Sign In for Pricing
View Details
Rat F-box only protein 38 (FBXO38) ELISA Kit
MBS7208826-03 5x 96 Well

Rat F-box only protein 38 (FBXO38) ELISA Kit

Sign In for Pricing
View Details
Rat F-box only protein 38 (FBXO38) ELISA Kit
MBS7208826-04 10x 96 Well

Rat F-box only protein 38 (FBXO38) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Caldesmon/CALD1 Antibody (CALD1/820) [DyLight 680]
NBP2-47818FR 0.1 mL

Mouse Monoclonal Caldesmon/CALD1 Antibody (CALD1/820) [DyLight 680]

Sign In for Pricing
View Details