Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit TFPI protein

This Rabbit TFPI protein spans the amino acid sequence from region 25-300a. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TFPI

UniProt

P19761

Expression Region

25-300a

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CAPN10 qPCR Primer Pair
QH07841S 200 Tests

Human CAPN10 qPCR Primer Pair

Sign In for Pricing
View Details
RASGAP Antibody / RASA1
R32007 100 µg

RASGAP Antibody / RASA1

Sign In for Pricing
View Details
MRG15 discontinued
539146-01 30ul

MRG15 discontinued

Sign In for Pricing
View Details
MRG15 discontinued
539146-02 100 µL

MRG15 discontinued

Sign In for Pricing
View Details
CD45RA Antibody (PE)
orb44332 100 Tests

CD45RA Antibody (PE)

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD161 Antibody[HP-3G10]
E-AB-F1155M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD161 Antibody[HP-3G10]

Sign In for Pricing
View Details