Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast SPT15 protein

This Yeast SPT15 protein spans the amino acid sequence from region 2-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SPT15

UniProt

P13393

Expression Region

2-240aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADEERLKEFKEANKIVFDPNTRQVWENQNRDGTKPATTFQSEEDIKRAAPESEKDTSATSGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQREEIYQAFEAIYPVLSEFRKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MB AC
MB250110.5G 5 g

TentaGel® MB AC

Sign In for Pricing
View Details
RPS24 (Center) Rabbit Polyclonal Antibody
AP53738PU-N 400 µL

RPS24 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Antithrombin (AT) ELISA Kit
RD-AT-Mu-01 96 Tests

Mouse Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details
Mouse Antithrombin (AT) ELISA Kit
RD-AT-Mu-02 48 Tests

Mouse Antithrombin (AT) ELISA Kit

Sign In for Pricing
View Details
cis-Aconitic Acid
TRC-A189890-1G 1 g

cis-Aconitic Acid

Sign In for Pricing
View Details
HDAC5 Rabbit Polyclonal Antibody
AP06158PU-N 100 µg

HDAC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details