Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SYN1 protein

This Human SYN1 protein spans the amino acid sequence from region 113-420aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SYN1

UniProt

P17600

Expression Region

113-420aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CaMKII Rabbit Monoclonal Antibody
E46F1765 40 µL

CaMKII Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Myelin Basic Protein/MBP Blocking Peptide
MBS9625911-01 1 mg

Myelin Basic Protein/MBP Blocking Peptide

Sign In for Pricing
View Details
Myelin Basic Protein/MBP Blocking Peptide
MBS9625911-02 5x 1 mg

Myelin Basic Protein/MBP Blocking Peptide

Sign In for Pricing
View Details
TMEM102 Human siRNA Oligo Duplex (Locus ID 284114)
SR317107 1 Kit

TMEM102 Human siRNA Oligo Duplex (Locus ID 284114)

Sign In for Pricing
View Details
SPIN4 Rabbit Polyclonal Antibody (FITC)
orb190526 100 µL

SPIN4 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rat Salusin-beta, SAL-B ELISA KIT
E1168Ra-01 48 Well

Rat Salusin-beta, SAL-B ELISA KIT

Sign In for Pricing
View Details