Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SYN1 protein

This Human SYN1 protein spans the amino acid sequence from region 113-420aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SYN1

UniProt

P17600

Expression Region

113-420aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRVLLVIDEPHTDWAKYFKGKKIHGEIDIKVEQAEFSDLNLVAHANGGFSVDMEVLRNGVKVVRSLKPDFVLIRQHAFSMARNGDYRSLVIGLQYAGIPSVNSLHSVYNFCDKPWVFAQMVRLHKKLGTEEFPLIDQTFYPNHKEMLSSTTYPVVVKMGHAHSGMGKVKVDNQHDFQDIASVVALTKTYATAEPFIDAKYDVRVQKIGQNYKAYMRTSVSGNWKTNTGSAMLEQIAMSDRYKLWVDTCSEIFGGLDICAVEALHGKDGRDHIIEVVGSSMPLIGDHQDEDKQLIVELVVNKMAQALPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABHD12, NT (Abhydrolase Domain-containing Protein 12, 2-arachidonoylglycerol Hydrolase, Monoacylglycerol Lipase ABHD12, C20orf22)
MBS623471-01 0.2 mL

ABHD12, NT (Abhydrolase Domain-containing Protein 12, 2-arachidonoylglycerol Hydrolase, Monoacylglycerol Lipase ABHD12, C20orf22)

Sign In for Pricing
View Details
ABHD12, NT (Abhydrolase Domain-containing Protein 12, 2-arachidonoylglycerol Hydrolase, Monoacylglycerol Lipase ABHD12, C20orf22)
MBS623471-02 5x 0.2 mL

ABHD12, NT (Abhydrolase Domain-containing Protein 12, 2-arachidonoylglycerol Hydrolase, Monoacylglycerol Lipase ABHD12, C20orf22)

Sign In for Pricing
View Details
Luteinizing Hormone beta (LH beta) (LHb/1214), 0.2mg/mL
BNUB1214-100 1x 100 µL

Luteinizing Hormone beta (LH beta) (LHb/1214), 0.2mg/mL

Sign In for Pricing
View Details
HAPLN1 Human
OM302886-01 2 µg

HAPLN1 Human

Sign In for Pricing
View Details
HAPLN1 Human
OM302886-02 10 µg

HAPLN1 Human

Sign In for Pricing
View Details
HAPLN1 Human
OM302886-03 1 mg

HAPLN1 Human

Sign In for Pricing
View Details