Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sort1 protein

This Rat Sort1 protein spans the amino acid sequence from region 610-754aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sort1

UniProt

O54861

Expression Region

610-754aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CYP2E1 Polyclonal Antibody
TMAB-04888-01 50 μL

Anti-CYP2E1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP2E1 Polyclonal Antibody
TMAB-04888-02 100 µL

Anti-CYP2E1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CYP2E1 Polyclonal Antibody
TMAB-04888-03 200 µL

Anti-CYP2E1 Polyclonal Antibody

Sign In for Pricing
View Details
Ficolin H (human) monoclonal antibody (FCN334) (biotin conjugate)
BPD-RIG-334-01B-015 150 µg

Ficolin H (human) monoclonal antibody (FCN334) (biotin conjugate)

Sign In for Pricing
View Details
SFRP1 Protein Vector (Human) (pPB-C-His)
PV128882 500 ng

SFRP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Contactin 1 (CNTN1) Human Over-expression Lysate
orb1374471 20 µg

Contactin 1 (CNTN1) Human Over-expression Lysate

Sign In for Pricing
View Details