Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Sort1 protein

This Rat Sort1 protein spans the amino acid sequence from region 610-754aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sort1

UniProt

O54861

Expression Region

610-754aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CEENDYTTWLAHSTDPGDYKDGCILGYKEQFLRLRKSSVCQNGRDYVVAKQPSICPCSLEDFLCDFGYFRPENASECVEQPELKGHELEFCLYGKEEHLTTNGYRKIPGDRCQGGMNPAREVKDLKKKCTSNFLNPKKQNSKSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COCH, ID (COCH, COCH5B2, Cochlin, COCH-5B2) (AP)
MBS6287493-01 0.2 mL

COCH, ID (COCH, COCH5B2, Cochlin, COCH-5B2) (AP)

Sign In for Pricing
View Details
COCH, ID (COCH, COCH5B2, Cochlin, COCH-5B2) (AP)
MBS6287493-02 5x 0.2 mL

COCH, ID (COCH, COCH5B2, Cochlin, COCH-5B2) (AP)

Sign In for Pricing
View Details
HSF2 Peptide
DF7072-BP 1 mg

HSF2 Peptide

Sign In for Pricing
View Details
CD19 Antibody
R33887-100UG 100 µg

CD19 Antibody

Sign In for Pricing
View Details
FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (MaxLight 490)
MBS6200766-01 0.1 mL

FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (MaxLight 490)

Sign In for Pricing
View Details
FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (MaxLight 490)
MBS6200766-02 5x 0.1 mL

FAM3C (ILEI, Protein FAM3C, Interleukin-like EMT Inducer, GS3786, GS3876) (MaxLight 490)

Sign In for Pricing
View Details