Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Sod1 protein

This Mouse Sod1 protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sod1

UniProt

P08228

Expression Region

2-154aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1166 (NM_146650) Mouse Tagged ORF Clone
MG204532 10 µg

Olfr1166 (NM_146650) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AMZ2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV718631 1.0 µg DNA

AMZ2P2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 UPF0114 protein YqhA (yqhA)
orb2930932-01 20 µg

Recombinant Escherichia coli O7:K1 UPF0114 protein YqhA (yqhA)

Sign In for Pricing
View Details
Recombinant Escherichia coli O7:K1 UPF0114 protein YqhA (yqhA)
orb2930932-02 100 µg

Recombinant Escherichia coli O7:K1 UPF0114 protein YqhA (yqhA)

Sign In for Pricing
View Details
Rat Adprh ELISA Kit
ELI-12081r 96 Tests

Rat Adprh ELISA Kit

Sign In for Pricing
View Details
Duck T Cell B Cell Activating Molecule Polyclonal Antibody ELISA Kit
MBS059170 Inquire

Duck T Cell B Cell Activating Molecule Polyclonal Antibody ELISA Kit

Sign In for Pricing
View Details