Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Laminin alpha 4 (LAMA4) activation kit by CRISPRa
GA102651 1 Kit

Human Laminin alpha 4 (LAMA4) activation kit by CRISPRa

Sign In for Pricing
View Details
Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate
LY418963 100 µg

Semenogelin II (SEMG2) (NM_003008) Human Over-expression Lysate

Sign In for Pricing
View Details
NFYC (NM_001142589) Human Over-expression Lysate
LY428192 100 µg

NFYC (NM_001142589) Human Over-expression Lysate

Sign In for Pricing
View Details
Arntl Mouse Gene Knockout Kit (CRISPR)
KN301604RB 1 Kit

Arntl Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PKR (EIF2AK2) pThr451 Rabbit Polyclonal Antibody
AP02528PU-N 100 µL

PKR (EIF2AK2) pThr451 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Taurocholic Acid Sodium Salt Hydrate
TRC-T008851-25G 25 g

Taurocholic Acid Sodium Salt Hydrate

Sign In for Pricing
View Details