Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant B7-H3/CD276 Monoclonal Antibody
AN301442L-01 50 µL

Recombinant B7-H3/CD276 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant B7-H3/CD276 Monoclonal Antibody
AN301442L-02 100 µL

Recombinant B7-H3/CD276 Monoclonal Antibody

Sign In for Pricing
View Details
PGM2L1 Mouse Monoclonal Antibody [Clone ID: OTI4G6]
CF812136 100 µg

PGM2L1 Mouse Monoclonal Antibody [Clone ID: OTI4G6]

Sign In for Pricing
View Details
HLVd TaqMan RT-PCR Kit
TM38750 100 Reactions

HLVd TaqMan RT-PCR Kit

Sign In for Pricing
View Details
H-Resorcinol[Spectrophotometric reagent for the determination of B by FIA]
TRC-R145303-50MG 50 mg

H-Resorcinol[Spectrophotometric reagent for the determination of B by FIA]

Sign In for Pricing
View Details
Azin1 Mouse Gene Knockout Kit (CRISPR)
KN501902 1 Kit

Azin1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details