Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SIVA1 protein

This Human SIVA1 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SIVA1

UniProt

O15304

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
E-UNEL-H0336-01 5x 96 Tests

Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit
E-UNEL-H0336-02 15x 96 Tests

Uncoated Human SIGLEC3 (Sialic Acid Binding Ig Like Lectin 3) ELISA Kit

Sign In for Pricing
View Details
PCR Ranger 100bp DNA Ladder
11300 100 Loads

PCR Ranger 100bp DNA Ladder

Sign In for Pricing
View Details
CD40, Mouse (FGK45.5), 0.2mg/mL
BNUB2005-500 1x 500 µL

CD40, Mouse (FGK45.5), 0.2mg/mL

Sign In for Pricing
View Details
rac threo-9,10-Dihydroxystearic Acid
TRC-D454750-50MG 50 mg

rac threo-9,10-Dihydroxystearic Acid

Sign In for Pricing
View Details
2-Chloro-4-fluoro-5-nitrobenzoic Acid
TRC-C367080-2.5G 2.5 g

2-Chloro-4-fluoro-5-nitrobenzoic Acid

Sign In for Pricing
View Details