Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SFTPC protein

This Human SFTPC protein spans the amino acid sequence from region 24-58aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SFTPC

UniProt

P11686

Expression Region

24-58aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

5.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-7, Active (CASP7, CASP-7, Apoptotic Protease Mch-3, CMH-1, ICE-like Apoptotic Protease 3, ICE-LAP3, MCH3) discontinued
C2087-29C9 100 µg

Caspase-7, Active (CASP7, CASP-7, Apoptotic Protease Mch-3, CMH-1, ICE-like Apoptotic Protease 3, ICE-LAP3, MCH3) discontinued

Sign In for Pricing
View Details
Horse Heat Shock Protein 90 (HSP90) ELISA Kit
MBS2803085-01 48 Tests

Horse Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
Horse Heat Shock Protein 90 (HSP90) ELISA Kit
MBS2803085-02 96 Tests

Horse Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
Horse Heat Shock Protein 90 (HSP90) ELISA Kit
MBS2803085-03 5x 96 Tests

Horse Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
Horse Heat Shock Protein 90 (HSP90) ELISA Kit
MBS2803085-04 10x 96 Tests

Horse Heat Shock Protein 90 (HSP90) ELISA Kit

Sign In for Pricing
View Details
5′-Deoxythymidine (Standard)
HY-124425R 1 Each

5′-Deoxythymidine (Standard)

Sign In for Pricing
View Details