Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEPP1 protein

This Human SEPP1 protein spans the amino acid sequence from region 20-381aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEPP1

UniProt

P49908

Expression Region

20-381aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YY1 Associated Factor 2 (YAF2) Antibody (FITC)
abx308534-01 20 µg

YY1 Associated Factor 2 (YAF2) Antibody (FITC)

Sign In for Pricing
View Details
YY1 Associated Factor 2 (YAF2) Antibody (FITC)
abx308534-02 50 µg

YY1 Associated Factor 2 (YAF2) Antibody (FITC)

Sign In for Pricing
View Details
YY1 Associated Factor 2 (YAF2) Antibody (FITC)
abx308534-03 100 µg

YY1 Associated Factor 2 (YAF2) Antibody (FITC)

Sign In for Pricing
View Details
YY1 Associated Factor 2 (YAF2) Antibody (FITC)
abx308534-04 200 µg

YY1 Associated Factor 2 (YAF2) Antibody (FITC)

Sign In for Pricing
View Details
YY1 Associated Factor 2 (YAF2) Antibody (FITC)
abx308534-05 1 mg

YY1 Associated Factor 2 (YAF2) Antibody (FITC)

Sign In for Pricing
View Details
CDKN2AIP (NM_017632) Human Recombinant Protein
E45H39713M5 20 µg

CDKN2AIP (NM_017632) Human Recombinant Protein

Sign In for Pricing
View Details