Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SAG protein

This Human SAG protein spans the amino acid sequence from region 1-405aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SAG

UniProt

P10523

Expression Region

1-405aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLN, CT (POLN, DNA polymerase nu) (Azide free) (HRP) discontinued
040249-HRP 200 µL

POLN, CT (POLN, DNA polymerase nu) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
DrySyn® Multi Vial
1211585 3 PK

DrySyn® Multi Vial

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)
MBS1289160-01 0.02 mg (E-Coli)

Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)
MBS1289160-02 0.1 mg (E-Coli)

Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)
MBS1289160-03 0.02 mg (Baculovirus)

Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)

Sign In for Pricing
View Details
Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)
MBS1289160-04 0.02 mg (Mammalian-Cell)

Recombinant Geobacter sulfurreducens N- (5'-phosphoribosyl)anthranilate isomerase (trpF)

Sign In for Pricing
View Details