Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNF7 protein

This Human RNF7 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dengue virus One-Step PCR kit
Oneq-H451-150R 150 Reactions

Dengue virus One-Step PCR kit

Sign In for Pricing
View Details
TNFRSF13C Protein (C-human IgG1-Fc & AVI, Human)
P529067 100 µg

TNFRSF13C Protein (C-human IgG1-Fc & AVI, Human)

Sign In for Pricing
View Details
CTAB-motified gold nanoparticles
NM005006 10 mL

CTAB-motified gold nanoparticles

Sign In for Pricing
View Details
OBTF4 (Octamer Binding Transcription Factor 4) Human ELISA Kit
F5227 96 Tests

OBTF4 (Octamer Binding Transcription Factor 4) Human ELISA Kit

Sign In for Pricing
View Details
3-Amino-4-anisic acid
FA71298-01 250 g

3-Amino-4-anisic acid

Sign In for Pricing
View Details
3-Amino-4-anisic acid
FA71298-02 500 g

3-Amino-4-anisic acid

Sign In for Pricing
View Details