Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNF7 protein

This Human RNF7 protein spans the amino acid sequence from region 2-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNF7

UniProt

Q9UBF6

Expression Region

2-113aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C14orf157 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0304407 1.0 µg DNA

C14orf157 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
PARP1 Polyclonal Antibody, PE-Cy7 Conjugated
bs-20763R-PE-Cy7 100 µL

PARP1 Polyclonal Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
Slc22a6-set siRNA/shRNA/RNAi Lentivector (Rat)
43963096 4x 500 ng

Slc22a6-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
SARS-CoV-2 (2019-nCoV) Spike RBD (N501Y) Protein (Fc Tag)
PO54789M4 100 µg

SARS-CoV-2 (2019-nCoV) Spike RBD (N501Y) Protein (Fc Tag)

Sign In for Pricing
View Details
Tripartite Motif-Containing Protein 32 (TRIM32) Antibody
abx006889-01 60 µL

Tripartite Motif-Containing Protein 32 (TRIM32) Antibody

Sign In for Pricing
View Details
Tripartite Motif-Containing Protein 32 (TRIM32) Antibody
abx006889-02 120 µL

Tripartite Motif-Containing Protein 32 (TRIM32) Antibody

Sign In for Pricing
View Details