Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast PR protein

This Yeast PR protein spans the amino acid sequence from region 31-229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PR

UniProt

P01238

Expression Region

31-229aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Sus scrofa (Pig)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Drosophila melanogaster Putative odorant receptor 83a (Or83a)
orb2904146-01 20 µg

Recombinant Drosophila melanogaster Putative odorant receptor 83a (Or83a)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Putative odorant receptor 83a (Or83a)
orb2904146-02 100 µg

Recombinant Drosophila melanogaster Putative odorant receptor 83a (Or83a)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)
MBS1119997-01 0.02 mg (E-Coli)

Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)
MBS1119997-02 0.02 mg (Yeast)

Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)
MBS1119997-03 0.1 mg (E-Coli)

Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)

Sign In for Pricing
View Details
Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)
MBS1119997-04 0.1 mg (Yeast)

Recombinant Salmonella typhimurium Beta-lactamase SHV-2 (bla)

Sign In for Pricing
View Details