Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Plaur protein

This Rat Plaur protein spans the amino acid sequence from region 25-299aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaur

UniProt

P49616

Expression Region

25-299aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-01 0.1 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-02 0.2 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-03 0.5 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-04 1 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-05 5 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details
Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)
MBS2002661-06 5x 5 mL

Polyclonal Antibody to Tissue Factor Pathway Inhibitor 2 (TFPI2)

Sign In for Pricing
View Details