Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeast def protein

This Yeast def protein spans the amino acid sequence from region 2-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Def

UniProt

P0A6K5

Expression Region

2-169aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli O157:H7

Field of Research

Infectious Disease & Virology; Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRCKα HDR Plasmid (m)
sc-432654-HDR 20 µg

MRCKα HDR Plasmid (m)

Sign In for Pricing
View Details
P2RX1 Protein (N-His, Human)
P506823 100 µg

P2RX1 Protein (N-His, Human)

Sign In for Pricing
View Details
RAGE Polyclonal Antibody
E-AB-70136-01 60 µL

RAGE Polyclonal Antibody

Sign In for Pricing
View Details
RAGE Polyclonal Antibody
E-AB-70136-02 120 µL

RAGE Polyclonal Antibody

Sign In for Pricing
View Details
RAGE Polyclonal Antibody
E-AB-70136-03 200 µL

RAGE Polyclonal Antibody

Sign In for Pricing
View Details
Dysprosium nitrate hydrate, 99.9%
GX4427-100g 100 g

Dysprosium nitrate hydrate, 99.9%

Sign In for Pricing
View Details