Human PCBD1 protein
This Human PCBD1 protein spans the amino acid sequence from region 2-104aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PCBD1
UniProt
P61457
Expression Region
2-104aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
13.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
Available Sizes
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3) discontinued](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
360937-01 50 µL
PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3) discontinued
Sign In for Pricing
View Details ![PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3) discontinued](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
360937-02 100 µL
PARP3 (Poly [ADP-ribose] Polymerase 3, PARP-3, hPARP-3, ADP-ribosyltransferase diphtheria toxin-like 3, ARTD3, IRT1, NAD (+) ADP-ribosyltransferase 3, ADPRT-3, Poly [ADP-ribose] Synthase 3, pADPRT-3, ADPRT3, ADPRTL3) discontinued
Sign In for Pricing
View Details 
31372116 3x 1.0 µg
Naa35 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
Sign In for Pricing
View Details