Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PCBD1 protein

This Human PCBD1 protein spans the amino acid sequence from region 2-104aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PCBD1

UniProt

P61457

Expression Region

2-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hlf Antibody - N-terminal region : Biotin (ARP31381_P050-Biotin)
ARP31381_P050-Biotin 100 µL

Hlf Antibody - N-terminal region : Biotin (ARP31381_P050-Biotin)

Sign In for Pricing
View Details
CAPN6 Antibody
E19-9321-2 100 µg -100 µL

CAPN6 Antibody

Sign In for Pricing
View Details
ALOX5AP Protein Vector (Rat) (pPM-C-His)
PV253329 500 ng

ALOX5AP Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Dnajc11 Rabbit Polyclonal Antibody (HRP)
orb2094776 100 µL

Dnajc11 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
pCMV-Myc-STK38 Plasmid
PVT59659 2 µg

pCMV-Myc-STK38 Plasmid

Sign In for Pricing
View Details
Pla2g5 ORF Vector (Mouse) (pORF)
ORF054185 1.0 µg DNA

Pla2g5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details