Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccl7 protein

This Mouse Ccl7 protein spans the amino acid sequence from region 28-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ccl7, Fic, Mcp3, Scya7

UniProt

Q03366

Expression Region

28-97aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-6730-5p antagomir
HY-RI02018A-01 5 nmol

Hsa-miR-6730-5p antagomir

Sign In for Pricing
View Details
Hsa-miR-6730-5p antagomir
HY-RI02018A-02 20 nmol

Hsa-miR-6730-5p antagomir

Sign In for Pricing
View Details
OR8D1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1543706 1.0 µg DNA

OR8D1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Asb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4914405 3x 1.0 µg

Asb3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Gtf2e2 ORF Vector (Mouse) (pORF)
ORF046782 1.0 µg DNA

Gtf2e2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
LAMP1 (NM_005561) Human Over-expression Lysate
E45H07764-2 20 µg

LAMP1 (NM_005561) Human Over-expression Lysate

Sign In for Pricing
View Details