Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccl7 protein

This Mouse Ccl7 protein spans the amino acid sequence from region 28-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ccl7, Fic, Mcp3, Scya7

UniProt

Q03366

Expression Region

28-97aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM17 Rabbit pAb
E45R25182N-50 50 µL

RBM17 Rabbit pAb

Sign In for Pricing
View Details
SB 204990
T16861-01 1 mg

SB 204990

Sign In for Pricing
View Details
SB 204990
T16861-02 5 mg

SB 204990

Sign In for Pricing
View Details
SB 204990
T16861-03 1 mL - 10 mM (in DMSO)

SB 204990

Sign In for Pricing
View Details
SB 204990
T16861-04 10 mg

SB 204990

Sign In for Pricing
View Details
SB 204990
T16861-05 25 mg

SB 204990

Sign In for Pricing
View Details