Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Ccl7 protein

This Mouse Ccl7 protein spans the amino acid sequence from region 28-97aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ccl7, Fic, Mcp3, Scya7

UniProt

Q03366

Expression Region

28-97aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTR2A Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV699540 1.0 µg DNA

HTR2A Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
MESP1 Blocking Peptide
MBS9620097-01 1 mg

MESP1 Blocking Peptide

Sign In for Pricing
View Details
MESP1 Blocking Peptide
MBS9620097-02 5x 1 mg

MESP1 Blocking Peptide

Sign In for Pricing
View Details
Cytochrome P450 17A1 (20 lyase, CP17A_HUMAN, CPT7, CYP17, CYP17A1, CYPXVII, Cytochrome P450 17A1, Cytochrome P450 family 17, Cytochrome P450 family 17 subfamily A polypeptide 1, Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia, Cytochrome p450 XVIIA1, Cytochrome P450-C17, Cytochrome P450c17, OTTHUMP00000020382, P450 C17, P450c17, S17AH, Steroid 17 alpha hydroxylase/17,20 lyase, Steroid 17 alpha monooxygenase, Steroid 17-alpha-hydroxylase/17, Steroid 17-alpha-monooxygenase)
143167 100 µL

Cytochrome P450 17A1 (20 lyase, CP17A_HUMAN, CPT7, CYP17, CYP17A1, CYPXVII, Cytochrome P450 17A1, Cytochrome P450 family 17, Cytochrome P450 family 17 subfamily A polypeptide 1, Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia, Cytochrome p450 XVIIA1, Cytochrome P450-C17, Cytochrome P450c17, OTTHUMP00000020382, P450 C17, P450c17, S17AH, Steroid 17 alpha hydroxylase/17,20 lyase, Steroid 17 alpha monooxygenase, Steroid 17-alpha-hydroxylase/17, Steroid 17-alpha-monooxygenase)

Sign In for Pricing
View Details
Magic™ Human IL4R CHO-S Cell Line
S01YF-0424-KX10 1 Vial

Magic™ Human IL4R CHO-S Cell Line

Sign In for Pricing
View Details
Biotinylated Anti-CD6 antibody (1G6) ; IgG1 Chimeric mAb
12-9493B-10 10 µg

Biotinylated Anti-CD6 antibody (1G6) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details