Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGFRAP1 protein

This Human NGFRAP1 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BrdU Mouse mAb
A21038 1000 μL

BrdU Mouse mAb

Sign In for Pricing
View Details
Cyp2b21 siRNA Oligos set (Rat)
17355176 3x 5 nmol

Cyp2b21 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Fmoc-cys (mtt) -oh
450456-01 100 mg

Fmoc-cys (mtt) -oh

Sign In for Pricing
View Details
Fmoc-cys (mtt) -oh
450456-02 250 mg

Fmoc-cys (mtt) -oh

Sign In for Pricing
View Details
Cofilin Recombinant Rabbit mAb
orb2322504-01 25 µL

Cofilin Recombinant Rabbit mAb

Sign In for Pricing
View Details
Cofilin Recombinant Rabbit mAb
orb2322504-02 50 µL

Cofilin Recombinant Rabbit mAb

Sign In for Pricing
View Details