Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NGFRAP1 protein

This Human NGFRAP1 protein spans the amino acid sequence from region 1-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NGFRAP1

UniProt

Q00994

Expression Region

1-111aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EG436003 shRNA (m) Lentiviral Particles
sc-143639-V 200 µL

EG436003 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Human pituitary adenylate cyclase activating polypeptide (PACAP) ELISA Kit
EIA06165h 1 Kit

Human pituitary adenylate cyclase activating polypeptide (PACAP) ELISA Kit

Sign In for Pricing
View Details
FCGR2B Antibody (Phospho-Tyr292)
OASG01282-100UL 100 µL

FCGR2B Antibody (Phospho-Tyr292)

Sign In for Pricing
View Details
Malachite Green For Microscopy
01610 00100 100 g

Malachite Green For Microscopy

Sign In for Pricing
View Details
Density Regulated Protein Rabbit pAb, BF700 conjugated
orb2867605 100 µL

Density Regulated Protein Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana KH domain-containing protein At3g08620 (At3g08620)
MBS1366083-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana KH domain-containing protein At3g08620 (At3g08620)

Sign In for Pricing
View Details