Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpmE protein

This E.coli rpmE protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmE, b3936, JW3907

UniProt

P0A7M9

Expression Region

1-70aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)
229303-01 250 mg

2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)

Sign In for Pricing
View Details
2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)
229303-02 1 g

2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)

Sign In for Pricing
View Details
2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)
229303-03 5 g

2- (2-Chlorophenoxy) propylamine ≥95% (HPLC)

Sign In for Pricing
View Details
Karyopherin beta 3 (IPO5) (NM_002271) Human Over-expression Lysate
LS003843 100 µg

Karyopherin beta 3 (IPO5) (NM_002271) Human Over-expression Lysate

Sign In for Pricing
View Details
Chicken Vitamin E ELISA Kit
MBS743365-01 48 Well

Chicken Vitamin E ELISA Kit

Sign In for Pricing
View Details
Chicken Vitamin E ELISA Kit
MBS743365-02 96 Well

Chicken Vitamin E ELISA Kit

Sign In for Pricing
View Details