Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E.coli rpmE protein

This E.coli rpmE protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RpmE, b3936, JW3907

UniProt

P0A7M9

Expression Region

1-70aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is GST-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKKDIHPKYEEITASCSCGNVMKIRSTVGHDLNLDVCSKCHPFFTGKQRDVATGGRVDRFNKRFNIPGSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uck2 ORF Vector (Mouse) (pORF)
ORF060975 1.0 µg DNA

Uck2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
mmu-miR-7239-3p miRNA Inhibitor
MIM03048 2x 5.0 nmol

mmu-miR-7239-3p miRNA Inhibitor

Sign In for Pricing
View Details
Reagecon 1977 Method Chemical Oxygen Demand (COD) Reagent
WTR50W 2.5 L

Reagecon 1977 Method Chemical Oxygen Demand (COD) Reagent

Sign In for Pricing
View Details
MPEP Hydrochloride
C04232 5 mg

MPEP Hydrochloride

Sign In for Pricing
View Details
Anti-Stefin B CSTB Antibody Picoband® (monoclonal, 2B6) Fluoro647 Conjugated
M02794-Fluoro647 100 µg/Vial

Anti-Stefin B CSTB Antibody Picoband® (monoclonal, 2B6) Fluoro647 Conjugated

Sign In for Pricing
View Details
MYST2 Protein Vector (Human) (pPM-C-His)
PV027432 500 ng

MYST2 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details